PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 776aa    MW: 85711.4 Da    PI: 6.5347
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.7e-23158259199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + + 
  XP_011089328.1 158 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEA 249
                     99****************************963.3445679************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     ++l ++++r+
  XP_011089328.1 250 GNLQLGIRRA 259
                     999***9986 PP

2Auxin_resp109.63.2e-36284365182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s++s+F+v+Y+Pras+++F+++++k++k  ++++ vG+Rfkm+++ +ds+err+sG+v+g sd+dp+rWpnSkWr+L
  XP_011089328.1 284 VANALSSNSTFHVFYSPRASRPDFIIPYQKYLKCATSQIPVGTRFKMRIDLDDSPERRFSGVVTGASDADPYRWPNSKWRCL 365
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-44149265IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-40151272IPR015300DNA-binding pseudobarrel domain
CDDcd100173.67E-22156258No hitNo description
SMARTSM010193.3E-22158260IPR003340B3 DNA binding domain
PfamPF023621.8E-21158259IPR003340B3 DNA binding domain
PROSITE profilePS5086312.858158260IPR003340B3 DNA binding domain
PfamPF065071.5E-30284365IPR010525Auxin response factor
PROSITE profilePS5174516.888666748IPR000270PB1 domain
SuperFamilySSF542773.58E-10666745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MEIDLNHAMG EVDKNACANG GECDKGEGGS CVSCCLSTST SSCSSNAPSA SSSSCSISAS  60
SSILIELWHA CAGPLTSLPK KGNLVVYFPQ GHLEQSNSAS FPPVEMPTFD LPSKILCRVV  120
DVHLLLEGVK LQGDENETKG VDEDGSGVAP AKSTSHMFCK TLTASDTSTH GGFSVPRRAA  180
EDCFPPLDYK QQRPSQELIA KDLHGVEWKF RHIYRGQPRR HLLTTGWSIF VSQKNLVSGD  240
AVLFLRGEAG NLQLGIRRAA RPRSGLPDCI IKNQNSYFNI LPPVANALSS NSTFHVFYSP  300
RASRPDFIIP YQKYLKCATS QIPVGTRFKM RIDLDDSPER RFSGVVTGAS DADPYRWPNS  360
KWRCLMVCWD DDIMSNHQVR VSPWDIDSSG NYAPVSILTS PGVKRLKSNQ EPSPHGNPIS  420
GSDQILDFEE SLRSSKVLQG QENIGLLSPI HGSDRINRQL HFEMQPLALN HLQNRIEKLN  480
YGEFMKNQTP ATFTGFLESN WFPKVLQGQE ICSLRSLAGE TGWNLGARST PELGCDVYNT  540
HQRPSFTLYP LASQGARNIP FSHTAGLKAG QGPLVLSNIS NFQMGNHVLT PTSVLSGPTT  600
DVSRVPNHRN EPWVLEKTSG PAIALTHLRN TTDKDNSQEK VPICKLFGYS LTEDPAIVNS  660
HSANKRSVTK VHKQGSLVWS AIDLSRLHGY NDLLTELERL FSMEGLLRDP NHGWRVLYTD  720
SENDMMVLGD DPWHEFIEEV TKIHIYTQEE VEKLTVGVNS DDTQSCLEEV PHVTDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1126039316359Auxin response factor 1
4ldy_B1e-1126039316359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089328.10.0PREDICTED: auxin response factor 4-like isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4